PDB entry 3rro

View 3rro on RCSB PDB site
Description: Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (FabG) from Vibrio cholerae
Class: oxidoreductase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, OXIDOREDUCTASE, FabG, acyl carrier protein, Cell Plasma
Deposited on 2011-04-29, released 2011-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-23, with a file datestamp of 2016-03-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-ketoacyl-(acyl-carrier-protein) reductase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VCD_002346
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rroa_
  • Chain 'B':
    Compound: 3-ketoacyl-(acyl-carrier-protein) reductase
    Species: Vibrio cholerae O1 biovar El Tor [TaxId:243277]
    Gene: VCD_002346
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rrob_
  • Heterogens: SO4, PGE, EDO, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rroA (A:)
    snamsqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdng
    kgmalnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnlts
    ifrlskavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrg
    vtvntvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitge
    tlhvnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rroA (A:)
    sqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgma
    lnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifrl
    skavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtvn
    tvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlhv
    nggmymi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rroB (B:)
    snamsqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdng
    kgmalnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnlts
    ifrlskavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrg
    vtvntvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitge
    tlhvnggmymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rroB (B:)
    sqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgma
    lnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifrl
    skavlrgmmkkrqgriinvgsvvgtmgnagqanyaaakagvigftksmarevasrgvtvn
    tvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlhv
    nggmymi