PDB entry 3rq5

View 3rq5 on RCSB PDB site
Description: Crystal Structure of ADP/ATP-dependent NAD(P)H-hydrate dehydratase from Bacillus subtilis co-crystallized with ATP/Mg2+ and soaked with CoA
Class: lyase/lyase substrate
Keywords: STRUCTURAL GENOMICS, PSI-BIOLOGY, PROTEIN STRUCTURE INITIATIVE, MIDWEST CENTER FOR STRUCTURAL GENOMICS, MCSG, LYASE, lyase-lyase substrate complex
Deposited on 2011-04-27, released 2011-07-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-09, with a file datestamp of 2013-01-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.154
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP/ATP-dependent NAD(P)H-hydrate dehydratase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU38720, yxkO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3rq5a_
  • Heterogens: COA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rq5A (A:)
    snamnvpfwteehvratlperdaeshkgtygtalllagsddmpgaallaglgamrsglgk
    lvigtsenviplivpvlpeatywrdgwkkaadaqleetyraiaigpglpqtesvqqavdh
    vltadcpvildagalakrtypkregpviltphpgeffrmtgvpvnelqkkraeyakewaa
    qlqtvivlkgnqtviafpdgdcwlnptgngalakggtgdtltgmilgmlcchedpkhavl
    navylhgacaelwtdehsahtllahelsdilprvwkrfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rq5A (A:)
    mnvpfwteehvratlperdtygtalllagsddmpgaallaglgamrsglgklvigtsenv
    iplivpvlpeatywrdgwkkaadaqleetyraiaigpglpqtesvqqavdhvltadcpvi
    ldagalakrtypkregpviltphpgeffrmtgvpvnelqkkraeyakewaaqlqtvivlk
    gnqtviafpdgdcwlnptgngalakggtgdtltgmilgmlcchedpkhavlnavylhgac
    aelwtdehsahtllahelsdilprvwkrfe