PDB entry 3rq0

View 3rq0 on RCSB PDB site
Description: The crystal structure of a glycosyl hydrolases (GH) family protein 16 from Mycobacterium smegmatis str. MC2 155
Class: hydrolase
Keywords: structural genomics, PSI-Biology, protein structure initiative, midwest center for structural genomics, MCSG, HYDROLASE
Deposited on 2011-04-27, released 2011-05-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-05-11, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.162
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycosyl hydrolases family protein 16
    Species: MYCOBACTERIUM SMEGMATIS [TaxId:246196]
    Gene: MSMEG_5345
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3rq0a_
  • Heterogens: CA, PO4, PEG, PG4, GOL, 211, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rq0A (A:)
    snamanvdrrqmlllsglgataavlpvpraaavpnqtaasyvfadefdgpagsapsaakw
    tiakaretiqdptyweqpgrigqyrndrrnvfldgksnlviraakdgdtyysaklasvwe
    ggaghtwearikfncltagawpafwlgntgegeldiiewygngswpsattvhaksnggew
    kthniavdngwhrwrtqwdaegarfwldytdgaqpyfevaasslpdwpfdqpgytmfvvl
    nlavagsgggdpsggtypadmlvdwvrvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rq0A (A:)
    syvfadefdgpagsapsaakwtiakaretiqdptyweqpgrigqyrndrrnvfldgksnl
    viraakdgdtyysaklasvweggaghtwearikfncltagawpafwlgntgegeldiiew
    ygngswpsattvhaksnggewkthniavdngwhrwrtqwdaegarfwldytdgaqpyfev
    aasslpdwpfdqpgytmfvvlnlavagsgggdpsggtypadmlvdwvrvw