PDB entry 3rpg

View 3rpg on RCSB PDB site
Description: Bmi1/Ring1b-UbcH5c complex structure
Class: ligase
Keywords: Ubiquitin Ligase, LIGASE
Deposited on 2011-04-26, released 2011-08-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.219
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 D3
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2D3, UBC5C, UBCH5C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61077 (3-148)
      • expression tag (0-2)
    Domains in SCOPe 2.03: d3rpga_
  • Chain 'B':
    Compound: Polycomb complex protein BMI-1
    Species: Homo sapiens [TaxId:9606]
    Gene: BMI1, PCGF4, RNF51
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: E3 ubiquitin-protein ligase RING2
    Species: Homo sapiens [TaxId:9606]
    Gene: RNF2, BAP1, DING, HIPI3, RING1B
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3rpgA (A:)
lgsalkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfpt
dypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddp
lvpeiariyktdrdkynrisrewtqkyam

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.