PDB entry 3rpb

View 3rpb on RCSB PDB site
Description: the c2b-domain of rabphilin: structural variations in a janus-faced domain
Deposited on 1999-04-19, released 1999-12-23
The last revision prior to the SCOP 1.57 freeze date was dated 1999-12-23, with a file datestamp of 1999-12-22.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d3rpba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rpbA (A:)
    rgkilvslmystqqgglivgiircvhlaamdangysdpfvklwlkpdmgkkakhktqikk
    ktlnpefneeffydikhsdlakksldisvwdydigksndyiggcqlgisakgerlkhwye
    clknkdkkierwhqlqnenh