PDB entry 3rpb

View 3rpb on RCSB PDB site
Description: the c2b-domain of rabphilin: structural variations in a janus-faced domain
Class: endocytosis/exocytosis
Keywords: c2-domains, c2b-domain, rabphilin, endocytosis/exocytosis complex
Deposited on 1999-04-19, released 1999-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rabphilin 3-a
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P47709 (0-139)
  Domains in SCOPe 2.08: d3rpba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3rpbA (A:)
  rgkilvslmystqqgglivgiircvhlaamdangysdpfvklwlkpdmgkkakhktqikk
  ktlnpefneeffydikhsdlakksldisvwdydigksndyiggcqlgisakgerlkhwye
  clknkdkkierwhqlqnenh