PDB entry 3rof

View 3rof on RCSB PDB site
Description: Crystal Structure of the S. aureus Protein Tyrosine Phosphatase PtpA
Class: hydrolase
Keywords: Phosphatase, HYDROLASE
Deposited on 2011-04-25, released 2011-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.03 Å
R-factor: N/A
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low molecular weight protein-tyrosine-phosphatase ptpA
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: ptpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C5D2 (5-156)
      • expression tag (0-4)
      • expression tag (157)
    Domains in SCOPe 2.07: d3rofa1, d3rofa2, d3rofa3
  • Chain 'B':
    Compound: Expression tag cleaved from protein-tyrosine-phosphatase ptpA
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: ptpA
    Database cross-references and differences (RAF-indexed):
    • PDB 3ROF (0-6)
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rofA (A:)
    ayfqgmvdvafvclgnicrspmaeaimrqrlkdrnihdikvhsrgtgswnlgepphegtq
    kilnkhnipfdgmiselfeatddfdyivamdqsnvdniksinpnlkgqlfkllefsnmee
    sdvpdpyytnnfegvydmvlsscdnlidyivkdanlkg
    

  • Chain 'B':
    No sequence available.