PDB entry 3ro9

View 3ro9 on RCSB PDB site
Description: Candida glabrata dihydrofolate reductase complexed with NADPH and 6-ethyl-5-[(3R)-3-[3-methoxy-5-(pyridin-4-yl)phenyl]but-1-yn-1-yl]pyrimidine-2,4-diamine (UCP1006)
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: Antifungal Agents, Candida glabrata, Drug Design, Enzyme Inhibitors, Fungal Proteins, Models, Molecular Structure, Structure-Activity Relationship, Tetrahydrofolate Dehydrogenase, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2011-04-25, released 2012-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Strain CBS138 chromosome J complete sequence
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0J03894g, DHFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FPH0 (0-214)
      • expression tag (215-224)
    Domains in SCOPe 2.07: d3ro9a1, d3ro9a2
  • Chain 'B':
    Compound: Strain CBS138 chromosome J complete sequence
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0J03894g, DHFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FPH0 (0-214)
      • expression tag (215-224)
    Domains in SCOPe 2.07: d3ro9b1, d3ro9b2
  • Heterogens: NDP, 06U, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ro9A (A:)
    kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi
    pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig
    ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq
    legrltsqewngelvkglpvqekgyqfyftlytkklehhhhhhhh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ro9B (B:)
    kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi
    pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig
    ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq
    legrltsqewngelvkglpvqekgyqfyftlytkklehhhhhhhh