PDB entry 3ro6

View 3ro6 on RCSB PDB site
Description: Crystal structure of Dipeptide Epimerase from Methylococcus capsulatus complexed with Mg ion
Class: isomerase
Keywords: TIM barrel, ISOMERASE
Deposited on 2011-04-25, released 2011-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative chloromuconate cycloisomerase
    Species: Methylococcus capsulatus [TaxId:414]
    Gene: MCA1834
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ro6a1, d3ro6a2
  • Chain 'B':
    Compound: Putative chloromuconate cycloisomerase
    Species: Methylococcus capsulatus [TaxId:414]
    Gene: MCA1834
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ro6b1, d3ro6b2
  • Chain 'C':
    Compound: Putative chloromuconate cycloisomerase
    Species: Methylococcus capsulatus [TaxId:414]
    Gene: MCA1834
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ro6c1, d3ro6c2
  • Chain 'D':
    Compound: Putative chloromuconate cycloisomerase
    Species: Methylococcus capsulatus [TaxId:414]
    Gene: MCA1834
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ro6d1, d3ro6d2
  • Chain 'E':
    Compound: Putative chloromuconate cycloisomerase
    Species: Methylococcus capsulatus [TaxId:414]
    Gene: MCA1834
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ro6e1, d3ro6e2
  • Chain 'F':
    Compound: Putative chloromuconate cycloisomerase
    Species: Methylococcus capsulatus [TaxId:414]
    Gene: MCA1834
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ro6f1, d3ro6f2
  • Heterogens: MG, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ro6A (A:)
    mkiadiqvrtehfpltrpyriafrsieeidnliveirtadgllglgaasperhvtgetle
    achaaldhdrlgwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplv
    eilgrahdslptsvtigikpveetlaearehlalgfrvlkvklcgdeeqdferlrrlhet
    lagravvrvdpnqsydrdgllrldrlvqelgiefieqpfpagrtdwlralpkairrriaa
    desllgpadafalaappaacgifniklmkcgglaparriatiaetagidlmwgcmdesri
    siaaalhaalacpatryldldgsfdlardvaeggfiledgrlrvterpglglvypd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ro6A (A:)
    mkiadiqvrtehfplteeidnliveirtadgllglgaasperhvtgetleachaaldhdr
    lgwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplveilgrahdsl
    ptsvtigikpveetlaearehlalgfrvlkvklcgdeeqdferlrrlhetlagravvrvd
    pnqsydrdgllrldrlvqelgiefieqpfpagrtdwlralpkairrriaadesllgpada
    falaappaacgifniklmkcgglaparriatiaetagidlmwgcmdesrisiaaalhaal
    acpatryldldgsfdlardvaeggfiledgrlrvterpglglvyp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ro6B (B:)
    mkiadiqvrtehfpltrpyriafrsieeidnliveirtadgllglgaasperhvtgetle
    achaaldhdrlgwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplv
    eilgrahdslptsvtigikpveetlaearehlalgfrvlkvklcgdeeqdferlrrlhet
    lagravvrvdpnqsydrdgllrldrlvqelgiefieqpfpagrtdwlralpkairrriaa
    desllgpadafalaappaacgifniklmkcgglaparriatiaetagidlmwgcmdesri
    siaaalhaalacpatryldldgsfdlardvaeggfiledgrlrvterpglglvypd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ro6B (B:)
    mkiadiqvrtehfplteeidnliveirtadgllglgaasperhvtgetleachaaldhdr
    lgwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplveilgrahdsl
    ptsvtigikpveetlaearehlalgfrvlkvklcgdeeqdferlrrlhetlagravvrvd
    pnqsydrdgllrldrlvqelgiefieqpfpagrtdwlralpkairrriaadesllgpada
    falaappaacgifniklmkcgglaparriatiaetagidlmwgcmdesrisiaaalhaal
    acpatryldldgsfdlardvaeggfiledgrlrvterpglglvy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ro6C (C:)
    mkiadiqvrtehfpltrpyriafrsieeidnliveirtadgllglgaasperhvtgetle
    achaaldhdrlgwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplv
    eilgrahdslptsvtigikpveetlaearehlalgfrvlkvklcgdeeqdferlrrlhet
    lagravvrvdpnqsydrdgllrldrlvqelgiefieqpfpagrtdwlralpkairrriaa
    desllgpadafalaappaacgifniklmkcgglaparriatiaetagidlmwgcmdesri
    siaaalhaalacpatryldldgsfdlardvaeggfiledgrlrvterpglglvypd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ro6C (C:)
    mkiadiqvrtehfpltreeidnliveirtadgllglgaasperhvtgetleachaaldhd
    rlgwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplveilgrahds
    lptsvtigikpveetlaearehlalgfrvlkvklcgdeeqdferlrrlhetlagravvrv
    dpnqsydrdgllrldrlvqelgiefieqpfpagrtdwlralpkairrriaadesllgpad
    afalaappaacgifniklmkcgglaparriatiaetagidlmwgcmdesrisiaaalhaa
    lacpatryldldgsfdlardvaeggfiledgrlrvterpglglvyp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ro6D (D:)
    mkiadiqvrtehfpltrpyriafrsieeidnliveirtadgllglgaasperhvtgetle
    achaaldhdrlgwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplv
    eilgrahdslptsvtigikpveetlaearehlalgfrvlkvklcgdeeqdferlrrlhet
    lagravvrvdpnqsydrdgllrldrlvqelgiefieqpfpagrtdwlralpkairrriaa
    desllgpadafalaappaacgifniklmkcgglaparriatiaetagidlmwgcmdesri
    siaaalhaalacpatryldldgsfdlardvaeggfiledgrlrvterpglglvypd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ro6D (D:)
    mkiadiqvrtehfplteidnliveirtadgllglgaasperhvtgetleachaaldhdrl
    gwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplveilgrahdslp
    tsvtigikpveetlaearehlalgfrvlkvklcgdeeqdferlrrlhetlagravvrvdp
    nqsydrdgllrldrlvqelgiefieqpfpagrtdwlralpkairrriaadesllgpadaf
    alaappaacgifniklmkcgglaparriatiaetagidlmwgcmdesrisiaaalhaala
    cpatryldldgsfdlardvaeggfiledgrlrvterpglglvyp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ro6E (E:)
    mkiadiqvrtehfpltrpyriafrsieeidnliveirtadgllglgaasperhvtgetle
    achaaldhdrlgwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplv
    eilgrahdslptsvtigikpveetlaearehlalgfrvlkvklcgdeeqdferlrrlhet
    lagravvrvdpnqsydrdgllrldrlvqelgiefieqpfpagrtdwlralpkairrriaa
    desllgpadafalaappaacgifniklmkcgglaparriatiaetagidlmwgcmdesri
    siaaalhaalacpatryldldgsfdlardvaeggfiledgrlrvterpglglvypd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ro6E (E:)
    mkiadiqvrtehfplteeidnliveirtadgllglgaasperhvtgetleachaaldhdr
    lgwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplveilgrahdsl
    ptsvtigikpveetlaearehlalgfrvlkvklcgdeeqdferlrrlhetlagravvrvd
    pnqsydrdgllrldrlvqelgiefieqpfpagrtdwlralpkairrriaadesllgpada
    falaappaacgifniklmkcgglaparriatiaetagidlmwgcmdesrisiaaalhaal
    acpatryldldgsfdlardvaeggfiledgrlrvterpglglvy
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ro6F (F:)
    mkiadiqvrtehfpltrpyriafrsieeidnliveirtadgllglgaasperhvtgetle
    achaaldhdrlgwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplv
    eilgrahdslptsvtigikpveetlaearehlalgfrvlkvklcgdeeqdferlrrlhet
    lagravvrvdpnqsydrdgllrldrlvqelgiefieqpfpagrtdwlralpkairrriaa
    desllgpadafalaappaacgifniklmkcgglaparriatiaetagidlmwgcmdesri
    siaaalhaalacpatryldldgsfdlardvaeggfiledgrlrvterpglglvypd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ro6F (F:)
    mkiadiqvrtehfplteeidnliveirtadgllglgaasperhvtgetleachaaldhdr
    lgwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplveilgrahdsl
    ptsvtigikpveetlaearehlalgfrvlkvklcgdeeqdferlrrlhetlagravvrvd
    pnqsydrdgllrldrlvqelgiefieqpfpagrtdwlralpkairrriaadesllgpada
    falaappaacgifniklmkcgglaparriatiaetagidlmwgcmdesrisiaaalhaal
    acpatryldldgsfdlardvaeggfiledgrlrvterpglglvy