PDB entry 3rnt

View 3rnt on RCSB PDB site
Description: crystal structure of guanosine-free ribonuclease t1, complexed with vanadate(v), suggests conformational change upon substrate binding
Deposited on 1989-05-31, released 1989-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1994-07-31, with a file datestamp of 1994-08-02.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.137
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d3rnt__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3rnt_ (-)
  acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
  ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect