PDB entry 3rns

View 3rns on RCSB PDB site
Description: Cupin 2 conserved barrel domain protein from Leptotrichia buccalis
Class: structural genomics, unknown function
Keywords: structural genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, conserved barrel domain, UNKNOWN FUNCTION
Deposited on 2011-04-22, released 2011-05-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-05-11, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.173
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cupin 2 conserved barrel domain protein
    Species: Leptotrichia buccalis [TaxId:523794]
    Gene: Lebu_0116
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7NCX6 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3rnsa1, d3rnsa2, d3rnsa3
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rnsA (A:)
    snamvkievakpinfnrlitskeaevvsmrilnqpnsyislfslakdeeitaeamlgnry
    yycfngngeifiennkktisngdfleitanhnysieardnlklieigekigdgnmenktl
    kmlesasafnlaevveyqegkivsknlvakpnlvmtimsfwkgesldphkapgdalvtvl
    dgegkyyvdgkpfivkkgesavlpaniphaveaetenfkmllilvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rnsA (A:)
    amvkievakpinfnrlitskeaevvsmrilnqpnsyislfslakdeeitaeamlgnryyy
    cfngngeifiennkktisngdfleitanhnysieardnlklieigekisafnlaevveyq
    egkivsknlvakpnlvmtimsfwkgesldphkapgdalvtvldgegkyyvdgkpfivkkg
    esavlpaniphaveaetenfkmllilvk