PDB entry 3rn8

View 3rn8 on RCSB PDB site
Description: Crystal Structure of iGluR2 Ligand Binding Domain and Symmetrical Carboxyl Containing Potentiator
Class: transport protein
Keywords: glutamate receptor potentiator complex, ligand gated ion channel, membrane, TRANSPORT PROTEIN
Deposited on 2011-04-22, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42262 (Start-117)
      • linker (118-119)
    • Uniprot P42262 (120-End)
      • see remark 999 (231)
    Domains in SCOPe 2.07: d3rn8a_
  • Chain 'B':
    Compound: Glutamate receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42262 (3-117)
      • linker (118-119)
    • Uniprot P42262 (120-End)
      • see remark 999 (231)
    Domains in SCOPe 2.07: d3rn8b_
  • Chain 'C':
    Compound: Glutamate receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42262 (Start-117)
      • linker (118-119)
    • Uniprot P42262 (120-End)
      • see remark 999 (231)
    Domains in SCOPe 2.07: d3rn8c_
  • Heterogens: GLU, RN8, ZN, ACT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rn8A (A:)
    rganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdg
    kygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgt
    piesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegva
    rvrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavl
    klneqglldklknkwwydkgecgsgggdskektsalslsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rn8A (A:)
    ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
    rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
    aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
    skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
    qglldklknkwwydkgec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rn8B (B:)
    rganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdg
    kygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgt
    piesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegva
    rvrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavl
    klneqglldklknkwwydkgecgsgggdskektsalslsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rn8B (B:)
    nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
    ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
    saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
    kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln
    eqglldklknkwwydkgec
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3rn8C (C:)
    rganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdg
    kygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgt
    piesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegva
    rvrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavl
    klneqglldklknkwwydkgecgsgggdskektsalslsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rn8C (C:)
    ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
    rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
    aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
    skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
    qglldklknkwwydkgec