PDB entry 3rn1

View 3rn1 on RCSB PDB site
Description: Crystal Structure of the W199E-MauG/pre-Methylamine Dehydrogenase Complex
Class: Oxidoreductase/electron transport
Keywords: MauG, methylamine dehydrogenase, c-heme, quinone cofactor, ELECTRON TRANSPORT, Oxidoreductase-electron transport complex
Deposited on 2011-04-21, released 2012-04-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.146
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methylamine utilization protein MauG
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: mauG, Pden_4736
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51658
      • engineered mutation (198)
  • Chain 'B':
    Compound: Methylamine utilization protein MauG
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: mauG, Pden_4736
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51658
      • engineered mutation (198)
  • Chain 'C':
    Compound: Methylamine dehydrogenase light chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_4733
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1BBA0 (Start-130)
      • expression tag (131-136)
    Domains in SCOPe 2.02: d3rn1c_
  • Chain 'D':
    Compound: Methylamine dehydrogenase heavy chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_4730
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Methylamine dehydrogenase light chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_4733
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3rn1e_
  • Chain 'F':
    Compound: Methylamine dehydrogenase heavy chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_4730
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, NA, HEC, EDO, 1PE, PG4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3rn1C (C:)
    adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
    cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
    ctispivgkashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rn1C (C:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkashhhhhh
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3rn1E (E:)
    adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
    cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
    ctispivgkashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rn1E (E:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgka
    

  • Chain 'F':
    No sequence available.