PDB entry 3rlz

View 3rlz on RCSB PDB site
Description: 2.0 Angstrom X-ray structure of bovine Ca(2+)-S100B D63N
Class: metal binding protein
Keywords: alpha-helical, EF hand, METAL BINDING PROTEIN
Deposited on 2011-04-20, released 2012-04-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.21
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-B
    Species: Bos taurus [TaxId:9913]
    Gene: S100B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02638 (0-End)
      • engineered mutation (63)
    Domains in SCOPe 2.05: d3rlza_
  • Chain 'B':
    Compound: Protein S100-B
    Species: Bos taurus [TaxId:9913]
    Gene: S100B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02638 (0-End)
      • engineered mutation (63)
    Domains in SCOPe 2.05: d3rlzb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rlzA (A:)
    mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldsngdgecdfqefmafvamittacheffehe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rlzA (A:)
    mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldsngdgecdfqefmafvamittacheffe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rlzB (B:)
    mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldsngdgecdfqefmafvamittacheffehe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rlzB (B:)
    mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldsngdgecdfqefmafvamittacheffe