PDB entry 3rli

View 3rli on RCSB PDB site
Description: Crystal structure of monoacylglycerol lipase from Bacillus sp. H257 in complex with PMSF
Class: hydrolase
Keywords: alpha/beta hydrolase, hydrolase
Deposited on 2011-04-19, released 2012-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.158
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermostable monoacylglycerol lipase
    Species: Bacillus sp. [TaxId:129908]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rlia_
  • Heterogens: MRD, PMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rliA (A:)
    mgsshhhhhhssglvprgshmseqypvlsgaepfyaengpvgvllvhgftgtphsmrpla
    eayakagytvclprlkghgthyedmerttfhdwvasveegygwlkqrcqtifvtglsmgg
    tltlylaehhpdicgivpinaavdipaiaagmtgggelpryldsigsdlknpdvkelaye
    ktptasllqlarlmaqtkakldrivcpalifvsdedhvvppgnadiifqgisstekeivr
    lrnsyhvatldydqpmiiersleffakhag
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rliA (A:)
    mseqypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgt
    hyedmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpin
    aavdipaiaaglpryldsigsdlknpdvkelayektptasllqlarlmaqtkakldrivc
    palifvsdedhvvppgnadiifqgisstekeivrlrnsyhvatldydqpmiiersleffa
    kha