PDB entry 3rkt

View 3rkt on RCSB PDB site
Description: Crystal Structure of the Manihot esculenta Hydroxynitrile Lyase (MeHNL) 3KP triple mutant
Class: lyase
Keywords: reversible, stereospecific metabolism, cyanohydrins, acetate cyanohydrin, LYASE
Deposited on 2011-04-18, released 2012-06-20
Made obsolete by 3x3h on 2016-03-02

The last revision prior to the SCOPe 2.05 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: 0.215
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydroxynitrilase
    Species: Manihot esculenta [TaxId:3983]
    Gene: HNL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52705 (0-257)
      • engineered mutation (175)
      • engineered mutation (198)
      • engineered mutation (223)
    Domains in SCOPe 2.05: d3rkta_
  • Chain 'B':
    Compound: Hydroxynitrilase
    Species: Manihot esculenta [TaxId:3983]
    Gene: HNL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52705 (0-257)
      • engineered mutation (175)
      • engineered mutation (198)
      • engineered mutation (223)
    Domains in SCOPe 2.05: d3rktb_
  • Chain 'C':
    Compound: Hydroxynitrilase
    Species: Manihot esculenta [TaxId:3983]
    Gene: HNL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52705 (0-257)
      • engineered mutation (175)
      • engineered mutation (198)
      • engineered mutation (223)
    Domains in SCOPe 2.05: d3rktc_
  • Chain 'D':
    Compound: Hydroxynitrilase
    Species: Manihot esculenta [TaxId:3983]
    Gene: HNL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52705 (0-257)
      • engineered mutation (175)
      • engineered mutation (198)
      • engineered mutation (223)
    Domains in SCOPe 2.05: d3rktd_
  • Chain 'E':
    Compound: Hydroxynitrilase
    Species: Manihot esculenta [TaxId:3983]
    Gene: HNL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52705 (0-257)
      • engineered mutation (175)
      • engineered mutation (198)
      • engineered mutation (223)
    Domains in SCOPe 2.05: d3rkte_
  • Chain 'F':
    Compound: Hydroxynitrilase
    Species: Manihot esculenta [TaxId:3983]
    Gene: HNL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52705 (0-257)
      • engineered mutation (175)
      • engineered mutation (198)
      • engineered mutation (223)
    Domains in SCOPe 2.05: d3rktf_
  • Chain 'G':
    Compound: Hydroxynitrilase
    Species: Manihot esculenta [TaxId:3983]
    Gene: HNL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52705 (0-257)
      • engineered mutation (175)
      • engineered mutation (198)
      • engineered mutation (223)
    Domains in SCOPe 2.05: d3rktg_
  • Chain 'H':
    Compound: Hydroxynitrilase
    Species: Manihot esculenta [TaxId:3983]
    Gene: HNL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52705 (0-257)
      • engineered mutation (175)
      • engineered mutation (198)
      • engineered mutation (223)
    Domains in SCOPe 2.05: d3rkth_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rktA (A:)
    mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
    lltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
    llesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrpgslf
    qnvlaqrpkftekgygsipkvyiwtdqdkiflpdfqrwqianyppdkvyqvqggdhklql
    tkteevahilqevadaya
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rktB (B:)
    mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
    lltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
    llesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrpgslf
    qnvlaqrpkftekgygsipkvyiwtdqdkiflpdfqrwqianyppdkvyqvqggdhklql
    tkteevahilqevadaya
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rktC (C:)
    mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
    lltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
    llesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrpgslf
    qnvlaqrpkftekgygsipkvyiwtdqdkiflpdfqrwqianyppdkvyqvqggdhklql
    tkteevahilqevadaya
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rktD (D:)
    mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
    lltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
    llesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrpgslf
    qnvlaqrpkftekgygsipkvyiwtdqdkiflpdfqrwqianyppdkvyqvqggdhklql
    tkteevahilqevadaya
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rktE (E:)
    mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
    lltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
    llesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrpgslf
    qnvlaqrpkftekgygsipkvyiwtdqdkiflpdfqrwqianyppdkvyqvqggdhklql
    tkteevahilqevadaya
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rktF (F:)
    mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
    lltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
    llesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrpgslf
    qnvlaqrpkftekgygsipkvyiwtdqdkiflpdfqrwqianyppdkvyqvqggdhklql
    tkteevahilqevadaya
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rktG (G:)
    mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
    lltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
    llesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrpgslf
    qnvlaqrpkftekgygsipkvyiwtdqdkiflpdfqrwqianyppdkvyqvqggdhklql
    tkteevahilqevadaya
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rktH (H:)
    mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
    lltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
    llesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrpgslf
    qnvlaqrpkftekgygsipkvyiwtdqdkiflpdfqrwqianyppdkvyqvqggdhklql
    tkteevahilqevadaya