PDB entry 3rks

View 3rks on RCSB PDB site
Description: Crystal Structure of the Manihot esculenta Hydroxynitrile Lyase (MeHNL) K176P mutant
Class: Lyase
Keywords: reversible, stereospecific metabolism, cyanohydrins, natural ligand, acetone, acetate, acetate cyanohydrin, Lyase
Deposited on 2011-04-18, released 2012-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.177
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydroxynitrilase
    Species: Manihot esculenta [TaxId:3983]
    Gene: HNL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52705 (0-257)
      • engineered mutation (175)
    Domains in SCOPe 2.07: d3rksa_
  • Chain 'B':
    Compound: Hydroxynitrilase
    Species: Manihot esculenta [TaxId:3983]
    Gene: HNL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52705 (0-257)
      • engineered mutation (175)
    Domains in SCOPe 2.07: d3rksb_
  • Chain 'C':
    Compound: Hydroxynitrilase
    Species: Manihot esculenta [TaxId:3983]
    Gene: HNL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52705 (0-257)
      • engineered mutation (175)
    Domains in SCOPe 2.07: d3rksc_
  • Chain 'D':
    Compound: Hydroxynitrilase
    Species: Manihot esculenta [TaxId:3983]
    Gene: HNL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52705 (0-257)
      • engineered mutation (175)
    Domains in SCOPe 2.07: d3rksd_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rksA (A:)
    mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
    lltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
    llesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrpgslf
    qnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdhklql
    tkteevahilqevadaya
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rksB (B:)
    mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
    lltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
    llesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrpgslf
    qnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdhklql
    tkteevahilqevadaya
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rksC (C:)
    mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
    lltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
    llesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrpgslf
    qnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdhklql
    tkteevahilqevadaya
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rksD (D:)
    mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
    lltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
    llesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrpgslf
    qnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdhklql
    tkteevahilqevadaya