PDB entry 3rkp

View 3rkp on RCSB PDB site
Description: Crystal structure of BcpA*(D312A), the major pilin subunit of Bacillus cereus
Class: cell adhesion
Keywords: intramolecular amide bond, jelly-roll, Ig, pilin subunit, CELL ADHESION
Deposited on 2011-04-18, released 2012-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.213
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Collagen adhesion protein
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_2508
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81D71 (Start-354)
      • engineered mutation (21)
      • engineered mutation (100)
      • engineered mutation (151)
      • engineered mutation (196)
      • engineered mutation (265)
    Domains in SCOPe 2.07: d3rkpa1, d3rkpa2, d3rkpa3
  • Chain 'B':
    Compound: Collagen adhesion protein
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_2508
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81D71
      • engineered mutation (21)
      • engineered mutation (100)
      • engineered mutation (151)
      • engineered mutation (196)
      • engineered mutation (265)
    Domains in SCOPe 2.07: d3rkpb1, d3rkpb2, d3rkpb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rkpA (A:)
    gsneikrgavdliktgvnekamagavfslfkkdgtevkkelatdanghirvqgleygeyy
    fqetkapkgyvidptkreffvknsgtinedgtitsgtvvkmevknneeptidkkingkle
    alpinpltnynydiktlipedikeykkyvvtatldnrlviqgkpivkidgaevnanvvev
    aiegqkvtatvkdftkmdgkkefhlqiksqvkegvpsgseilntakihftnkndvigeke
    skpvvvipttgiieltkidsanknkmkgaefvlkdnngkivvvagkevtgvsdengvikw
    snipygdyqifetkaptytkedgtktsyqllkdpidvkisennqtvkltiennks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rkpA (A:)
    krgavdliktgvnekamagavfslfkkdgtevkkelatdanghirvqgleygeyyfqetk
    apkgyvidptkreffvknsgtinedgtitsgtvvkmevknneeptidkkingklealpin
    pltnynydiktlipedikeykkyvvtatldnrlviqgkpivkidgaevnanvvevaiegq
    kvtatvkdftkmdgkkefhlqiksqvkegvpsgseilntakihftnkndvigekeskpvv
    vipttgiieltkidsanknkmkgaefvlkdnngkivvvagkevtgvsdengvikwsnipy
    gdyqifetkaptytkedgtktsyqllkdpidvkisennqtvkltiennks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rkpB (B:)
    gsneikrgavdliktgvnekamagavfslfkkdgtevkkelatdanghirvqgleygeyy
    fqetkapkgyvidptkreffvknsgtinedgtitsgtvvkmevknneeptidkkingkle
    alpinpltnynydiktlipedikeykkyvvtatldnrlviqgkpivkidgaevnanvvev
    aiegqkvtatvkdftkmdgkkefhlqiksqvkegvpsgseilntakihftnkndvigeke
    skpvvvipttgiieltkidsanknkmkgaefvlkdnngkivvvagkevtgvsdengvikw
    snipygdyqifetkaptytkedgtktsyqllkdpidvkisennqtvkltiennks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rkpB (B:)
    krgavdliktgvnekamagavfslfkkdgtevkkelatdanghirvqgleygeyyfqetk
    apkgyvidptkreffvknsgtinedgtitsgtvvkmevknneeptidkkingklealpin
    pltnynydiktlipedikeykkyvvtatldnrlviqgkpivkidgaevnanvvevaiegq
    kvtatvkdftkmdgkkefhlqiksqvkegvpsgseilntakihftnkndvigekeskpvv
    vipttgiieltkidsanknkmkgaefvlkdnngkivvvagkevtgvsdengvikwsnipy
    gdyqifetkaptytkedgtktsyqllkdpidvkisennqtvkltiennk