PDB entry 3rjs

View 3rjs on RCSB PDB site
Description: Crystal structure of Dynein Light Chain 8a (DLC8) from Toxoplasma gondii at 1.5 A resolution
Class: motor protein
Keywords: Parasite, dynein light chain, LC8, DLC8, TgDLC8, DYNEIN, LIGHT CHAIN, PIN, DLC1, DYNLL1, MOTOR PROTEIN, TRANSPORT PROTEIN
Deposited on 2011-04-15, released 2012-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.194
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain motor protein
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rjsa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rjsA (A:)
    madrkaviknadmpedlqqdaidcanqalekyniekdiaafikkefdrkhnptwhcvvgr
    nfgsyvthethhfiyfyigqvavllfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rjsA (A:)
    drkaviknadmpedlqqdaidcanqalekyniekdiaafikkefdrkhnptwhcvvgrnf
    gsyvthethhfiyfyigqvavllfksg