PDB entry 3rjq

View 3rjq on RCSB PDB site
Description: Crystal structure of anti-HIV llama VHH antibody A12 in complex with C186 gp120
Class: Viral Protein/Immune system
Keywords: Ig VH domain, anti-HIV, Viral Protein-Immune system complex
Deposited on 2011-04-15, released 2012-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-12, with a file datestamp of 2012-09-07.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.257
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C186 gp120
    Species: Human immunodeficiency virus type 1 [TaxId:11706]
    Database cross-references and differences (RAF-indexed):
    • PDB 3RJQ
  • Chain 'B':
    Compound: Llama VHH A12
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 3RJQ (0-End)
    Domains in SCOPe 2.07: d3rjqb_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rjqB (B:)
    avqlqesggglvqaggslrlsctasgrisssydmgwfrqapgkerefvaaiswsggttdy
    adsvkgrfaiskdnaknavylqmnslkpedtavyycaakwrplrysdypsnsdyydwgqg
    tqvtvsseqkliseedlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rjqB (B:)
    avqlqesggglvqaggslrlsctasgrisssydmgwfrqapgkerefvaaiswsggttdy
    adsvkgrfaiskdnaknavylqmnslkpedtavyycaakwrplrysdypsnsdyydwgqg
    tqvtvss