PDB entry 3rjn

View 3rjn on RCSB PDB site
Description: Horse heart myoglobin: D44K/D60K mutant with zinc (II) -deuteroporphyrin dimethyl ester
Class: Oxygen transport
Keywords: Oxygen transport
Deposited on 2011-04-15, released 2012-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Myoglobin
    Species: EQUUS CABALLUS [TaxId:9796]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68082 (0-152)
      • engineered mutation (43)
      • engineered mutation (59)
    Domains in SCOPe 2.07: d3rjnb_
  • Heterogens: SO4, HE5, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rjnB (B:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfkkfkhlkteaemkasek
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg