PDB entry 3rj9

View 3rj9 on RCSB PDB site
Description: Structure of alcohol dehydrogenase from Drosophila lebanonesis T114V mutant complexed with NAD+
Class: oxidoreductase
Keywords: short-chain dehydrogenase, oxidoreductase, detoxification, NAD metabolism
Deposited on 2011-04-15, released 2012-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-08, with a file datestamp of 2012-08-03.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.209
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase
    Species: Scaptodrosophila lebanonensis [TaxId:7225]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10807 (0-253)
      • engineered mutation (113)
    Domains in SCOPe 2.07: d3rj9a_
  • Chain 'B':
    Compound: alcohol dehydrogenase
    Species: Scaptodrosophila lebanonensis [TaxId:7225]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10807 (0-253)
      • engineered mutation (113)
    Domains in SCOPe 2.07: d3rj9b_
  • Chain 'C':
    Compound: alcohol dehydrogenase
    Species: Scaptodrosophila lebanonensis [TaxId:7225]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10807 (0-253)
      • engineered mutation (113)
    Domains in SCOPe 2.07: d3rj9c_
  • Chain 'D':
    Compound: alcohol dehydrogenase
    Species: Scaptodrosophila lebanonensis [TaxId:7225]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10807 (0-253)
      • engineered mutation (113)
    Domains in SCOPe 2.07: d3rj9d_
  • Chain 'E':
    Compound: alcohol dehydrogenase
    Species: Scaptodrosophila lebanonensis [TaxId:7225]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10807 (0-253)
      • engineered mutation (113)
    Domains in SCOPe 2.07: d3rj9e_
  • Chain 'F':
    Compound: alcohol dehydrogenase
    Species: Scaptodrosophila lebanonensis [TaxId:7225]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10807 (0-253)
      • engineered mutation (113)
    Domains in SCOPe 2.07: d3rj9f_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rj9A (A:)
    mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
    tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvnvttaild
    fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
    pgitrtplvhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgt
    leaiewtkhwdshi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rj9B (B:)
    mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
    tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvnvttaild
    fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
    pgitrtplvhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgt
    leaiewtkhwdshi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rj9C (C:)
    mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
    tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvnvttaild
    fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
    pgitrtplvhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgt
    leaiewtkhwdshi
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rj9D (D:)
    mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
    tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvnvttaild
    fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
    pgitrtplvhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgt
    leaiewtkhwdshi
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rj9E (E:)
    mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
    tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvnvttaild
    fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
    pgitrtplvhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgt
    leaiewtkhwdshi
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rj9F (F:)
    mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
    tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvnvttaild
    fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
    pgitrtplvhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgt
    leaiewtkhwdshi