PDB entry 3rj6

View 3rj6 on RCSB PDB site
Description: Crystal Structure of Horse heart ferric myoglobin; K45E/K63E/K96E mutant
Class: Oxygen transport
Keywords: Oxygen transport
Deposited on 2011-04-15, released 2012-05-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 1.23 Å
R-factor: 0.174
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: EQUUS CABALLUS [TaxId:9796]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68082 (0-152)
      • engineered mutation (44)
      • engineered mutation (62)
      • engineered mutation (95)
    Domains in SCOPe 2.06: d3rj6a_
  • Chain 'B':
    Compound: Myoglobin
    Species: EQUUS CABALLUS [TaxId:9796]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68082 (0-152)
      • engineered mutation (44)
      • engineered mutation (62)
      • engineered mutation (95)
    Domains in SCOPe 2.06: d3rj6b_
  • Heterogens: HEM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rj6A (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdefkhlkteaemkased
    lkehgtvvltalggilkkkghheaelkplaqshatehkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rj6B (B:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdefkhlkteaemkased
    lkehgtvvltalggilkkkghheaelkplaqshatehkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg