PDB entry 3rj5

View 3rj5 on RCSB PDB site
Description: Structure of alcohol dehydrogenase from Drosophila lebanonesis T114V mutant complexed with NAD+
Class: oxidoreductase
Keywords: short-chain dehydrogenases/reductases, oxidoreductase, detoxification, NAD metabolism
Deposited on 2011-04-15, released 2012-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-08, with a file datestamp of 2012-08-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.206
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol dehydrogenase
    Species: Scaptodrosophila lebanonensis [TaxId:7225]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10807 (0-253)
      • engineered mutation (113)
    Domains in SCOPe 2.07: d3rj5a_
  • Chain 'B':
    Compound: alcohol dehydrogenase
    Species: Scaptodrosophila lebanonensis [TaxId:7225]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10807 (0-253)
      • engineered mutation (113)
    Domains in SCOPe 2.07: d3rj5b_
  • Heterogens: ACY, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rj5A (A:)
    mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
    tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvnvttaild
    fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
    pgitrtplvhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgt
    leaiewtkhwdshi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rj5B (B:)
    mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
    tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvnvttaild
    fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
    pgitrtplvhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgt
    leaiewtkhwdshi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rj5B (B:)
    mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
    tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvnvttaild
    fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
    pgitrhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgtleai
    ewtkhwdshi