PDB entry 3rii

View 3rii on RCSB PDB site
Description: Crystal structure of the catalytic domain of UCHL5, a proteasome-associated human deubiquitinating enzyme, reveals an unproductive form of the enzyme
Class: hydrolase
Keywords: alpha-beta-alpha fold, Thiol hydroalse, Cysteine protease, deubiquitinating enzyme, ubiquitin hydrolase, HYDROLASE
Deposited on 2011-04-13, released 2011-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase isozyme L5
    Species: Homo sapiens [TaxId:9606]
    Gene: AD-019, CGI-70, UCH37, UCHL5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y5K5
      • engineered mutation (92)
    Domains in SCOPe 2.07: d3riia_
  • Chain 'B':
    Compound: Ubiquitin carboxyl-terminal hydrolase isozyme L5
    Species: Homo sapiens [TaxId:9606]
    Gene: AD-019, CGI-70, UCH37, UCHL5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y5K5
      • engineered mutation (92)
    Domains in SCOPe 2.07: d3riib_
  • Heterogens: EDO, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3riiA (A:)
    gplgsmtgnagewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhglifl
    fkwqpgeepagsvvqdsrldtiffakqvinnasatqaivsvllncthqdvhlgetlsefk
    efsqsfdaamkglalsnsdvirqvhnsfarqqmfefdtktsakeedafhfvsyvpvngrl
    yeldglregpidlgacnqddwisavrpviekriqkysegeirfnlmaivsdrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3riiA (A:)
    gewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepa
    gsvvqdsrldtiffakqvinnasatqaivsvllncthqdvhlgetlsefkefsqsfdaam
    kglalsnsdvirqvhnsfarqakeedafhfvsyvpvngrlyeldglregpidlgacnqdd
    wisavrpviekriqkysegeirfnlmaivsdr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3riiB (B:)
    gplgsmtgnagewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhglifl
    fkwqpgeepagsvvqdsrldtiffakqvinnasatqaivsvllncthqdvhlgetlsefk
    efsqsfdaamkglalsnsdvirqvhnsfarqqmfefdtktsakeedafhfvsyvpvngrl
    yeldglregpidlgacnqddwisavrpviekriqkysegeirfnlmaivsdrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3riiB (B:)
    ewclmesdpgvftelikgfgcrgaqveeiwslepenfeklkpvhgliflfkwqpgeepag
    svvqdsrldtiffakqvinnasatqaivsvllncthqdvhlgetlsefkefsqsfdaamk
    glalsnsdvirqvhnsfartktsakeedafhfvsyvpvngrlyeldglregpidlgacnq
    ddwisavrpviekriqkysegeirfnlmaivsdr