PDB entry 3rig

View 3rig on RCSB PDB site
Description: Sirt5 is an NAD-dependent protein lysine demalonylase and desuccinylase
Class: hydrolase
Keywords: protein lysine demalonylase/desuccinylase, Zn-binding domain, Rossmann fold, Mitochondria, HYDROLASE
Deposited on 2011-04-13, released 2011-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent deacetylase sirtuin-5
    Species: Homo sapiens [TaxId:9606]
    Gene: SIR2L5, SIRT5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NXA8 (4-272)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d3riga1, d3riga2
  • Chain 'B':
    Compound: NAD-dependent deacetylase sirtuin-5
    Species: Homo sapiens [TaxId:9606]
    Gene: SIR2L5, SIRT5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NXA8 (4-272)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d3rigb1, d3rigb2
  • Chain 'C':
    Compound: peptide of histone 3 thioacetyl-lysine 9
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3RIG
  • Chain 'D':
    Compound: peptide of histone 3 thioacetyl-lysine 9
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3RIG
  • Heterogens: ZN, NHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rigA (A:)
    gsftarpsssmadfrkffakakhiviisgagvsaesgvptfrgaggywrkwqaqdlatpl
    afahnpsrvwefyhyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrka
    gtknlleihgslfktrctscgvvaenykspicpalsgkgapepgtqdasipveklprcee
    agcggllrphvvwfgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargv
    pvaefntettpatnrfrfhfqgpcgttlpeala
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rigA (A:)
    sftarpsssmadfrkffakakhiviisgagvggywrkwqaqdlatplafahnpsrvwefy
    hyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagtknlleihgslf
    ktrctscgvvaenykspicpalsgkgapepgtqdasipveklprceeagcggllrphvvw
    fgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpvaefntettpat
    nrfrfhfqgpcgttlpeala
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rigB (B:)
    gsftarpsssmadfrkffakakhiviisgagvsaesgvptfrgaggywrkwqaqdlatpl
    afahnpsrvwefyhyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrka
    gtknlleihgslfktrctscgvvaenykspicpalsgkgapepgtqdasipveklprcee
    agcggllrphvvwfgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargv
    pvaefntettpatnrfrfhfqgpcgttlpeala
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rigB (B:)
    ftarpsssmadfrkffakakhiviisgaaggywrkwqaqdlatplafahnpsrvwefyhy
    rrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagtknlleihgslfkt
    rctscgvvaenykspicpalsgkgapepgtqdasipveklprceeagcggllrphvvwfg
    enldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpvaefntettpatnr
    frfhfqgpcgttlpeala
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.