PDB entry 3ri8

View 3ri8 on RCSB PDB site
Description: Xylanase C from Aspergillus kawachii D37N mutant
Class: hydrolase
Keywords: beta-jellyroll, Hydrolase, Extracellular
Deposited on 2011-04-13, released 2011-10-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.171
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-xylanase 3
    Species: Aspergillus kawachii [TaxId:40384]
    Gene: XYNC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33557
      • see remark 999 (15)
      • engineered mutation (37)
      • see remark 999 (53)
    Domains in SCOPe 2.06: d3ri8a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ri8A (A:)
    msaginyvqnyngnlgdftydesagtfsmywedgvssnfvvglgwttgssnaitysaeys
    asgsssylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnep
    sitgtstftqyfsvrestrtsgtvtvanhfnfwaqhgfgnsdfnyqvmaveawsgagsas
    vtiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ri8A (A:)
    aginyvqnyngnlgdftydesagtfsmywedgvssnfvvglgwttgssnaitysaeysas
    gsssylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsi
    tgtstftqyfsvrestrtsgtvtvanhfnfwaqhgfgnsdfnyqvmaveawsgagsasvt
    is