PDB entry 3ri6

View 3ri6 on RCSB PDB site
Description: A Novel Mechanism of Sulfur Transfer Catalyzed by O-Acetylhomoserine Sulfhydrylase in Methionine Biosynthetic Pathway of Wolinella succinogenes
Class: transferase
Keywords: Wolinella succinogenes O-acetylhomoserine sulfhydrylase, pyridoxal-5'-phosphate, gamma-elimination, direct sulfhydrylation, Cys/Met metabolism, O-acetylhomoserine, protein thiocarboxylate, TRANSFERASE
Deposited on 2011-04-13, released 2011-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: o-acetylhomoserine sulfhydrylase
    Species: Wolinella succinogenes [TaxId:844]
    Gene: mety, WS1012
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ri6a_
  • Chain 'B':
    Compound: o-acetylhomoserine sulfhydrylase
    Species: Wolinella succinogenes [TaxId:844]
    Gene: mety, WS1012
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ri6b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ri6A (A:)
    mgsdkihhhhhhssgenlyfqghmrgfttralhvpkakrdvhgalrtpvydnaafefens
    deiaqvslgralghvysrssnptvedleqrlknltgalgvlalgsgmaaistailtlara
    gdsvvttdrlfghtlslfqktlpsfgievrfvdvmdslavehacdettkllfletisnpq
    lqvadlealskvvhakgiplvvdttmtppylleakrlgvdievlsstkfisgggtsvggv
    lidhglfewkslpslapyyakagpmaflykarkevfqnlgpslsphnaylqslgletmal
    rierscqnaqelahwllsipqvkcvnhpslpdspfyaiakrqfryagsiltfeleskeas
    yrfmdalklirratnihdnkslilspyhviyalnsheerlkleispammrlsvgieeied
    lkedilqalc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ri6A (A:)
    rgfttralhvpsnptvedleqrlknltgalgvlalgsgmaaistailtlaragdsvvttd
    rlfghtlslfqktlpsfgievrfvdvmdslavehacdettkllfletisnpqlqvadlea
    lskvvhakgiplvvdttmtppylleakrlgvdievlsstkfisgggtsvggvlidhglfe
    wkslpslapyyakagpmaflykarkevfqnlgpslsphnaylqslgletmalrierscqn
    aqelahwllsipqvkcvnhpslpdspfyaiakrqfryagsiltfeleskeasyrfmdalk
    lirratnihdnkslilspyhvilkleispammrlsvgieeiedlkedilqalc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ri6B (B:)
    mgsdkihhhhhhssgenlyfqghmrgfttralhvpkakrdvhgalrtpvydnaafefens
    deiaqvslgralghvysrssnptvedleqrlknltgalgvlalgsgmaaistailtlara
    gdsvvttdrlfghtlslfqktlpsfgievrfvdvmdslavehacdettkllfletisnpq
    lqvadlealskvvhakgiplvvdttmtppylleakrlgvdievlsstkfisgggtsvggv
    lidhglfewkslpslapyyakagpmaflykarkevfqnlgpslsphnaylqslgletmal
    rierscqnaqelahwllsipqvkcvnhpslpdspfyaiakrqfryagsiltfeleskeas
    yrfmdalklirratnihdnkslilspyhviyalnsheerlkleispammrlsvgieeied
    lkedilqalc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ri6B (B:)
    rgfttralhvsnptvedleqrlknltgalgvlalgsgmaaistailtlaragdsvvttdr
    lfghtlslfqktlpsfgievrfvdvmdslavehacdettkllfletisnpqlqvadleal
    skvvhakgiplvvdttmtppylleakrlgvdievlsstkfigtsvggvlidhglfewksl
    pslapyyakagpmaflykarkevfqnlgpslsphnaylqslgletmalrierscqnaqel
    ahwllsipqvkcvnhpslpdspfyaiakrqfryagsiltfeleskeasyrfmdalklirr
    atnihdnkslilspyispammrlsvgieeiedlkedilqal