PDB entry 3rhy

View 3rhy on RCSB PDB site
Description: Crystal structure of the dimethylarginine dimethylaminohydrolase adduct with 4-chloro-2-hydroxymethylpyridine
Class: hydrolase
Keywords: enzyme adduct, HYDROLASE
Deposited on 2011-04-12, released 2011-06-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.209
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N(G),N(G)-dimethylarginine dimethylaminohydrolase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA1195
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3rhya_
  • Chain 'B':
    Compound: N(G),N(G)-dimethylarginine dimethylaminohydrolase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA1195
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3rhyb_
  • Heterogens: HM3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rhyA (A:)
    mfkhiiartparslvdgltsshlgkpdyakaleqhnayiralqtcdvditllppderfpd
    svfvedpvlctsrcaiitrpgaesrrgeteiieetvqrfypgkverieapgtveagdimm
    vgdhfyigesartnaegarqmiailekhglsgsvvrlekvlhlktglaylehnnllaage
    fvskpefqdfniieipeeesyaanciwvnervimpagyprtrekiarlgyrvievdtsey
    rkidggvscmslrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rhyA (A:)
    mfkhiiartparslvdlgkpdyakaleqhnayiralqtcdvditllppderfpdsvfved
    pvlctsrcaiitrpgaesrrgeteiieetvqrfypgkverieapgtveagdimmvgdhfy
    igesartnaegarqmiailekhglsgsvvrlekvlhlktglaylehnnllaagefvskpe
    fqdfniieipeeesyaanciwvnervimpagyprtrekiarlgyrvievdtseyrkidgg
    vscmslrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rhyB (B:)
    mfkhiiartparslvdgltsshlgkpdyakaleqhnayiralqtcdvditllppderfpd
    svfvedpvlctsrcaiitrpgaesrrgeteiieetvqrfypgkverieapgtveagdimm
    vgdhfyigesartnaegarqmiailekhglsgsvvrlekvlhlktglaylehnnllaage
    fvskpefqdfniieipeeesyaanciwvnervimpagyprtrekiarlgyrvievdtsey
    rkidggvscmslrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rhyB (B:)
    mfkhiiartparslvdlgkpdyakaleqhnayiralqtcdvditllppderfpdsvfved
    pvlctsrcaiitrpgaesrrgeteiieetvqrfypgkverieapgtveagdimmvgdhfy
    igesartnaegarqmiailekhglsgsvvrlekvlhlktglaylehnnllaagefvskpe
    fqdfniieipeeesyaanciwvnervimpagyprtrekiarlgyrvievdtseyrkidgg
    vscmslrf