PDB entry 3rhu

View 3rhu on RCSB PDB site
Description: Epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins
Class: de novo protein
Keywords: protein grafting, flexible backbone design, epitope-scaffold, HIV, immunogen design, DE NOVO PROTEIN
Deposited on 2011-04-12, released 2011-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SC_1wnu
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: alaXS, PH0574
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58307 (Start-44)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (30)
    • Uniprot O58307 (60-End)
    Domains in SCOPe 2.07: d3rhua_
  • Chain 'B':
    Compound: SC_1wnu
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: alaXS, PH0574
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58307 (Start-44)
      • engineered mutation (21-22)
      • engineered mutation (25)
      • engineered mutation (30)
    • Uniprot O58307 (60-End)
    Domains in SCOPe 2.07: d3rhub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rhuA (A:)
    sysievrthsalhvvkgavvktagsdakwttstyvkgnkgvlivkaalepdkwgiaaiea
    lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
    tkttgeigpikirkvrfrkskglleihfellelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rhuA (A:)
    ysievrthsalhvvkgavvktagsdakwttstyvkgnkgvlivkaalepdkwgiaaieal
    anekvkenapikiyelpreeaekmfgedmydilkvvviedwnvnacnkehtkttgeigpi
    kirkvrfrkskglleihfell
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rhuB (B:)
    sysievrthsalhvvkgavvktagsdakwttstyvkgnkgvlivkaalepdkwgiaaiea
    lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
    tkttgeigpikirkvrfrkskglleihfellelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rhuB (B:)
    ysievrthsalhvvkgavvktagsdakwttstyvkgnkgvlivkaalepdkwgiaaieal
    anekvkenapikiyelpreeaekmfgedmydilkvvviedwnvnacnkehtkttgeigpi
    kirkvrfrkskglleihfell