PDB entry 3rhs

View 3rhs on RCSB PDB site
Description: Phosphopantetheine adenylyltransferase from Mycobacterium tuberculosis complexed with CoA
Class: transferase
Keywords: transferase, coa
Deposited on 2011-04-12, released 2012-04-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.212
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: coaD, kdtB, Rv2965c, MT3043, MTCY349.22, u0002e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3rhsa_
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rhsA (A:)
    mtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkestth
    lpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
    rysfvssslakevamlggdvsellpepvnrrlrdrln