PDB entry 3rhk

View 3rhk on RCSB PDB site
Description: Crystal structure of the catalytic domain of c-Met kinase in complex with ARQ 197
Class: transferase/transferase inhibitor
Keywords: kinase, receptor tyrosine kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-04-11, released 2011-04-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.203
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3rhka_
  • Chain 'B':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3rhkb_
  • Heterogens: M97, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rhkA (A:)
    mghhhhhhmgdsdisspllqntvhidlsalnpelvqavqhvvigpsslivhfnevigrgh
    fgcvyhgtlldndgkkihcavkslnritdigevsqfltegiimkdfshpnvlsllgiclr
    segsplvvlpymkhgdlrnfirnethnptvkdligfglqvakgmkylaskkfvhrdlaar
    ncmldekftvkvadfglardmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvws
    fgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrp
    sfselvsrisaifstfig
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rhkA (A:)
    ntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihca
    vkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnf
    irnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglard
    mydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvn
    tfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rhkB (B:)
    mghhhhhhmgdsdisspllqntvhidlsalnpelvqavqhvvigpsslivhfnevigrgh
    fgcvyhgtlldndgkkihcavkslnritdigevsqfltegiimkdfshpnvlsllgiclr
    segsplvvlpymkhgdlrnfirnethnptvkdligfglqvakgmkylaskkfvhrdlaar
    ncmldekftvkvadfglardmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvws
    fgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrp
    sfselvsrisaifstfig
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rhkB (B:)
    llqntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkki
    hcavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdl
    rnfirnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfgl
    ardmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappyp
    dvntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstf