PDB entry 3rh1

View 3rh1 on RCSB PDB site
Description: X-ray Structure of a cis-proline (P114) to alanine variant of Ribonuclease A
Class: hydrolase
Keywords: PROTEI, ribonuclease fold, ribonuclease, RNA, HYDROLASE
Deposited on 2011-04-11, released 2012-02-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.182
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease pancreatic
  Species: Bos taurus [TaxId:9913]
  Gene: RNASE1, RNS1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-123)
    • engineered mutation (113)
  Domains in SCOPe 2.08: d3rh1a_
• Heterogens: CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3rh1A (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnayvpvhf
  dasv