PDB entry 3rgr

View 3rgr on RCSB PDB site
Description: Crystal structure of ketosteroid isomerase M116A from Pseudomonas putida
Class: isomerase
Keywords: Isomerase
Deposited on 2011-04-08, released 2012-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445 (0-End)
      • engineered mutation (115)
    Domains in SCOPe 2.07: d3rgra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rgrA (A:)
    mnlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtaqayw
    sevnlsvrepq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgrA (A:)
    mnlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtaqayw
    sevnlsvr