PDB entry 3rgn

View 3rgn on RCSB PDB site
Description: Crystal structure of spin-labeled BtuB W371R1
Class: transport protein
Keywords: Beta-barrel, Receptor, Transporter, Cobalamins, TonB, Outer Membrane, TRANSPORT PROTEIN
Deposited on 2011-04-08, released 2011-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin B12 transporter btuB
    Species: Escherichia coli [TaxId:83333]
    Gene: btuB, bfe, cer, dcrC, b3966, JW3938
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06129 (Start-593)
      • engineered mutation (370)
    Domains in SCOPe 2.08: d3rgna_
  • Heterogens: C8E, MG, MTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rgnA (A:)
    qdtspdtlvvtanrfeqprstvlapttvvtrqdidrwqstsvndvlrrlpgvditqnggs
    gqlssifirgtnashvlvlidgvrlnlagvsgsadlsqfpialvqrveyirgprsavygs
    daiggvvniittrdepgteisagwgsnsyqnydvstqqqlgdktrvtllgdyahthgydv
    vaygntgtqaqtdndgflsktlygalehnftdawsgfvrgygydnrtnydayyspgspll
    dtrklysqswdaglryngeliksqlitsyshskdynydphygrydssatldemkqytvqw
    annvivghgsigagvdwqkqtttpgtgyvedgydqrntgiyltglqqvgdftfegaarsd
    dnsqfgrhgtcqtsagwefiegyrfiasygtsykapnlgqlygfygnpnldpekskqweg
    afegltagvnwrisgyrndvsdlidyddhtlkyynegkarikgveatanfdtgplthtvs
    ydyvdarnaitdtpllrrakqqvkyqldwqlydfdwgityqylgtrydkdyssypyqtvk
    mggvslwdlavaypvtshltvrgkianlfdkdyetvygyqtagreytlsgsytf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rgnA (A:)
    dtlvvtanrfeqprstvlapttvvtrqdidrwqstsvndvlrrlpgvditqnggsgqlss
    ifirgtnashvlvlidgvrlnlagvsgsadlsqfpialvqrveyirgprsavygsdaigg
    vvniittrdepgteisagwgsnsyqnydvstqqqlgdktrvtllgdyahthggflsktly
    galehnftdawsgfvrgygydnrtntrklysqswdaglryngeliksqlitsyshskdyn
    ysatldemkqytvqwannvivghgsigagvdwqkqtttpgtgyvedgydqrntgiyltgl
    qqvgdftfegaarsddnsqfgrhgtcqtsagwefiegyrfiasygtsykapnlgqlygfy
    gnpnldpekskqwegafegltagvnwrisgyrndvsdlidyddhtlkyynegkarikgve
    atanfdtgplthtvsydyvdarnaitdtpllrrakqqvkyqldwqlydfdwgityqylgt
    rydkdyssypyqtvkmggvslwdlavaypvtshltvrgkianlfdkdyetvygyqtagre
    ytlsgsytf