PDB entry 3rev

View 3rev on RCSB PDB site
Description: Crystal structure of human alloreactive tcr nb20
Class: immune system
Keywords: t cell receptor, MHC class I, tumour antigen, immune system, immune response, alloreactivity, immunoglobulin domain
Deposited on 2011-04-05, released 2012-01-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.232
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tcr nb20 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3REV (0-202)
    Domains in SCOPe 2.06: d3reva1, d3reva2
  • Chain 'B':
    Compound: tcr nb20 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3REV (0-239)
    Domains in SCOPe 2.06: d3revb1, d3revb2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3revA (A:)
    qsvaqpedqvnvaegnpltvkctysvsgnpylfwyvqypnrglqfllkyitgdnlvkgsy
    gfeaefnksqtsfhlkkpsalvsdsalyfcavrdmnsgntplvfgkgtrlsvianiqkpd
    pavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaws
    nksdfacanafnnsiipedtffp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3revA (A:)
    qsvaqpedqvnvaegnpltvkctysvsgnpylfwyvqypnrglqfllkyitgdnlvkgsy
    gfeaefnksqtsfhlkkpsalvsdsalyfcavrdmnsgntplvfgkgtrlsvianiqkpd
    pavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaws
    nkfacanafnnsiipedtffp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3revB (B:)
    gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
    gynvsrsttedfplrllsaapsqtsvyfcassyvsqnneqffgpgtrltvledlknvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra