PDB entry 3ref

View 3ref on RCSB PDB site
Description: Crystal structure of EhRho1 bound to GDP and Magnesium
Class: signaling protein
Keywords: cytoskeleton, nucleotide-binding, GTP-binding, signaling protein, lipoprotein, prenylation
Deposited on 2011-04-04, released 2011-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.159
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho-like small GTPase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EhRho1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3refa_
  • Chain 'B':
    Compound: Rho-like small GTPase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EhRho1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3refb_
  • Heterogens: GDP, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3refA (A:)
    snamlafsdmntgagkiengkkalkivvvgdgavgktclllafskgeiptayvptvfenf
    shvmkykneefilhlwdtagqeeydrlrplsyadsdvvllcfavnnrtsfdnistkwepe
    ikhyidtaktvlvglkvdlrkdgsddvtkqegddlcqklgcvayieassvakiglnevfe
    ksvdcifsnkpvpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3refA (A:)
    gkiengkkalkivvvgdgavgktclllafskgeiptayvptvfenfshvmkykneefilh
    lwdtagqeeydrlrplsyadsdvvllcfavnnrtsfdnistkwepeikhyidtaktvlvg
    lkvdlrkdgsddvtkqegddlcqklgcvayieassvakiglnevfeksvdcif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3refB (B:)
    snamlafsdmntgagkiengkkalkivvvgdgavgktclllafskgeiptayvptvfenf
    shvmkykneefilhlwdtagqeeydrlrplsyadsdvvllcfavnnrtsfdnistkwepe
    ikhyidtaktvlvglkvdlrkdgsddvtkqegddlcqklgcvayieassvakiglnevfe
    ksvdcifsnkpvpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3refB (B:)
    gkiengkkalkivvvgdgavgktclllafskgeiptayvptvfenfshvmkykneefilh
    lwdtagqeeydrlrplsyadsdvvllcfavnnrtsfdnistkwepeikhyidtaktvlvg
    lkvdlrkdgsddvtkqegddlcqklgcvayieassvakiglnevfeksvdcifsnkpvpk