PDB entry 3rea

View 3rea on RCSB PDB site
Description: HIV-1 Nef protein in complex with engineered Hck-SH3 domain
Class: protein binding
Keywords: HIV-1 Nef, SH3 domain binding, signaling, Hck SH3 domain, PROTEIN BINDING
Deposited on 2011-04-04, released 2011-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-01, with a file datestamp of 2011-05-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.17
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein Nef
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: HIV-1 Nef, nef
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03407
      • engineered mutation (14)
    Domains in SCOPe 2.07: d3reaa_
  • Chain 'B':
    Compound: Tyrosine-protein kinase HCK
    Species: Homo sapiens [TaxId:9606]
    Gene: HCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08631 (1-60)
      • engineered mutation (12-17)
    Domains in SCOPe 2.07: d3reab_
  • Chain 'C':
    Compound: Protein Nef
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: HIV-1 Nef, nef
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03407 (Start-165)
      • engineered mutation (14)
      • engineered mutation (165)
    Domains in SCOPe 2.07: d3reac_
  • Chain 'D':
    Compound: Tyrosine-protein kinase HCK
    Species: Homo sapiens [TaxId:9606]
    Gene: HCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08631 (1-End)
      • initiating methionine (0)
      • engineered mutation (12-17)
    Domains in SCOPe 2.07: d3read_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3reaA (A:)
    gamassntaatnadsawleaqeeeevgfpvrpqvplrpmtykaaldishflkekgglegl
    iwsqrrqeildlwiyhtqgyfpdwqnytpgpgirypltfgwcfklvpvepekveeanege
    nnsllhpmslhgmedaekevlvwrfdsklafhhmarelhpeyykda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3reaA (A:)
    nadsawleaqeeeevgfpvrpqvplrpmtykaaldishflkekgglegliwsqrrqeild
    lwiyhtqgyfpdwqnytpgpgirypltfgwcfklvpvepedaekevlvwrfdsklafhhm
    arelhpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3reaB (B:)
    mediivvalydyvswspddlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvd
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3reaB (B:)
    ediivvalydyvswspddlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvds
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3reaC (C:)
    gamassntaatnadsawleaqeeeevgfpvrpqvplrpmtykaaldishflkekgglegl
    iwsqrrqeildlwiyhtqgyfpdwqnytpgpgirypltfgwcfklvpvepekveeanege
    nnsllhpmslhgmedaekevlvwrfdsklafhhmarelhpeyykda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3reaC (C:)
    sawleaqeeeevgfpvrpqvplrpmtykaaldishflkekgglegliwsqrrqeildlwi
    yhtqgyfpdwqnytpgpgirypltfgwcfklvpveekevlvwrfdsklafhhmarelhpe
    yykda
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3reaD (D:)
    mediivvalydyvswspddlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvd
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3reaD (D:)
    mediivvalydyvswspddlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvd