PDB entry 3re6

View 3re6 on RCSB PDB site
Description: Crystal structure of R4-6 streptavidin
Class: biotin binding protein
Keywords: Streptavidin variants, improved desthiobiotin binding, opened loop destabilization, BIOTIN BINDING PROTEIN
Deposited on 2011-04-02, released 2011-07-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (25-End)
      • expression tag (24)
      • engineered mutation (41)
      • engineered mutation (65)
      • engineered mutation (102)
      • engineered mutation (120)
      • engineered mutation (122)
    Domains in SCOPe 2.08: d3re6a1, d3re6a2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3re6A (A:)
msgshhhhhhssgiegrgrlikhmtaeagitgtwynqlgstlivtagadgaltgtyesav
gnaessyvltgrydsapatdgsgtalgwtvawknnyrnahsastwsgqyvggaearintq
vlttsgtteanawkstlvghdtftkvkpsaasi

    Sequence, based on observed residues (ATOM records): (download) 
    >3re6A (A:)
taeagitgtwynqlgstlivtagadgaltgtyesnaessyvltgrydsapatdgsgtalg
wtvawknnyrnahsastwsgqyvggaearintqvlttsgtteanawkstlvghdtftkvk
p