PDB entry 3re5

View 3re5 on RCSB PDB site
Description: Crystal structure of R4-6 streptavidin
Class: biotin binding protein
Keywords: Streptavidin variants, improved desthiobiotin binding, opened loop destabilization, BIOTIN BINDING PROTEIN
Deposited on 2011-04-02, released 2011-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-06, with a file datestamp of 2011-07-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.205
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (25-End)
      • expression tag (23-24)
      • engineered mutation (41)
      • engineered mutation (65)
      • engineered mutation (102)
      • engineered mutation (120)
      • engineered mutation (122)
    Domains in SCOPe 2.07: d3re5a1, d3re5a2
  • Heterogens: 1PE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3re5A (A:)
    msgshhhhhhssgiegrgrlikhmtaeagitgtwynqlgstlivtagadgaltgtyesav
    gnaessyvltgrydsapatdgsgtalgwtvawknnyrnahsastwsgqyvggaearintq
    vlttsgtteanawkstlvghdtftkvkpsaasi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3re5A (A:)
    mtaeagitgtwynqlgstlivtagadgaltgtyesavgnaessyvltgrydsapatdgsg
    talgwtvawknnyrnahsastwsgqyvggaearintqvlttsgtteanawkstlvghdtf
    tkvkp