PDB entry 3re2

View 3re2 on RCSB PDB site
Description: Crystal structure of menin reveals the binding site for Mixed Lineage Leukemia (MLL) protein
Class: unknown function
Keywords: menin, Multiple Endocrine Neoplasia 1, Tumor suppressor, Mixed Lineage Leukemia, UNKNOWN FUNCTION
Deposited on 2011-04-02, released 2011-07-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.163
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Predicted protein
    Species: Nematostella vectensis [TaxId:45351]
    Gene: v1g241841
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3re2a1, d3re2a2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3re2A (A:)
    gpamagksipfplkdiksvvevfrqelrndqpnlaqlsivlgffesastmkagdttstps
    ldeetfdalhckfmallqrdftfnagglpatreivknvadlvwgclaksyfkdrphiqnl
    ysfltgnrldcfgvafavvamcqalgyndvhlalsedhawvvfgkdkietaevtwhgkgn
    edkrgkpviyqdddrcswlylngnavhctrhmevasiissinpninhttdsiqlsqlqqe
    llwllydmghiktypmaianlgdleeisptpgrppaeelfkeaitvakreysdhhiypyt
    ylggyyyrkkkyyeaiaswvdagyvagkynyskddeemykefheiandlipnilkdavak
    adpsgtgstnltsdpkffalvlqfydgiclweegsptpvlhadwakklvqsigkfapecr
    safnantdtlslrsakmremknlittsgklntsamklqltaqsqvnvpksrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3re2A (A:)
    ksipfplkdiksvvevfrqelrndqpnlaqlsivlgffesastmtpsldeetfdalhckf
    mallqrdftfnagglpatreivknvadlvwgclaksyfkdrphiqnlysfltgnrldcfg
    vafavvamcqalgyndvhlalsedhawvvfgkdkietaevtwhgkgnedkrgkpviyqdd
    drcswlylngnavhctrhmevasiissinpninhttdsiqlsqlqqellwllydmghikt
    ypmaianlgdleeisptpgrppaeelfkeaitvakreysdhhiypytylggyyyrkkkyy
    eaiaswvdagyvagkynyskddeemykefheiandlipnilkdavakanltsdpkffalv
    lqfydgiclweegsptpvlhadwakklvqsigkfapecrsafnantdtlslrsakmremk
    nlitntsamklqlta