PDB entry 3rdz

View 3rdz on RCSB PDB site
Description: Crystal Structure of rBTI-trypsin complex at 2.26 angstrom resolution
Class: hydrolase/hydrolase inhibitor
Keywords: serine protease inhibitor, potato inhibitor I, trypsin inhibitor, trypsin, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2011-04-02, released 2011-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-06, with a file datestamp of 2011-07-01.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.183
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rdza_
  • Chain 'B':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rdzb_
  • Chain 'C':
    Compound: BWI-1=PROTEASE inhibitor/trypsin inhibitor
    Species: Fagopyrum esculentum [TaxId:3617]
    Gene: BWI-1, Edn1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rdzc_
  • Chain 'D':
    Compound: BWI-1=PROTEASE inhibitor/trypsin inhibitor
    Species: Fagopyrum esculentum [TaxId:3617]
    Gene: BWI-1, Edn1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rdzd_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rdzA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rdzA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslvasislptscasagtqclisgwgn
    tkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggpvvc
    sgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rdzB (B:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rdzB (B:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslvasislptscasagtqclisgwgn
    tkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggpvvc
    sgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3rdzC (C:)
    mrgshhhhhhlrqcsgkqewpelvgergskaakiienenedvraivlpegsavprdlrcd
    rvwvfvdergvvvdtpvvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rdzC (C:)
    qcsgkqewpelvgergskaakiienenedvraivlpegsavprdlrcdrvwvfvdergvv
    vdtpvvm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3rdzD (D:)
    mrgshhhhhhlrqcsgkqewpelvgergskaakiienenedvraivlpegsavprdlrcd
    rvwvfvdergvvvdtpvvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rdzD (D:)
    qcsgkqewpelvgergskaakiienenedvraivlpegsavprdlrcdrvwvfvdergvv
    vdtpvvm