PDB entry 3rdn

View 3rdn on RCSB PDB site
Description: nmr structure of the n-terminal domain with a linker portion of antarctic eel pout antifreeze protein rd3, minimized average structure
Class: antifreeze
Keywords: antifreeze protein, thermal hysteresis protein, ice binding protein
Deposited on 1998-02-24, released 1999-02-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antifreeze protein rd3 type III
    Species: Lycodichthys dearborni [TaxId:8201]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3rdna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rdnA (A:)
    mnkasvvanqlipintaltlimmkaevvtpmgipaeeipnlvgmqvnravplgttlmpdm
    vknyedgttspglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rdnA (A:)
    nkasvvanqlipintaltlimmkaevvtpmgipaeeipnlvgmqvnravplgttlmpdmv
    knyedgttspglk