PDB entry 3rdn

View 3rdn on RCSB PDB site
Description: nmr structure of the n-terminal domain with a linker portion of antarctic eel pout antifreeze protein rd3, minimized average structure
Class: antifreeze
Keywords: antifreeze protein, thermal hysteresis protein, ice binding protein
Deposited on 1998-02-24, released 1999-02-23
The last revision prior to the SCOP 1.75 freeze date was dated 1999-02-23, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: antifreeze protein rd3 type III
  Species: Rhigophila dearborni
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35753 (1-73)
  Domains in SCOP 1.75: d3rdna_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3rdnA (A:)
  mnkasvvanqlipintaltlimmkaevvtpmgipaeeipnlvgmqvnravplgttlmpdm
  vknyedgttspglk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3rdnA (A:)
  nkasvvanqlipintaltlimmkaevvtpmgipaeeipnlvgmqvnravplgttlmpdmv
  knyedgttspglk