PDB entry 3rdn

View 3rdn on RCSB PDB site
Description: nmr structure of the n-terminal domain with a linker portion of antarctic eel pout antifreeze protein rd3, minimized average structure
Deposited on 1998-02-24, released 1999-02-23
The last revision prior to the SCOP 1.57 freeze date was dated 1999-02-23, with a file datestamp of 1999-02-23.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d3rdn__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3rdn_ (-)
  nkasvvanqlipintaltlimmkaevvtpmgipaeeipnlvgmqvnravplgttlmpdmv
  knyedgttspglk