PDB entry 3rdm

View 3rdm on RCSB PDB site
Description: Crystal structure of R7-2 streptavidin complexed with biotin/PEG
Class: biotin binding protein
Keywords: Streptavidin variants, improved desthiobiotin binding, opened loop destabilization, BIOTIN BINDING PROTEIN
Deposited on 2011-04-01, released 2011-07-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-06, with a file datestamp of 2011-07-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.216
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (25-End)
      • expression tag (24)
      • engineered mutation (41)
      • engineered mutation (64-65)
      • engineered mutation (102)
      • engineered mutation (120)
      • engineered mutation (122)
    Domains in SCOPe 2.03: d3rdma_
  • Heterogens: 1PE, BTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3rdmA (A:)
msgshhhhhhssgiegrgrlikhmtaeagitgtwynqlgstlivtagadgaltgtyesav
gnaegsyvltgrydsapatdgsgtalgwtvawknnyrnahsastwsgqyvggaearintq
vlttsgtteanawkstlvghdtftkvkpsaasi

    Sequence, based on observed residues (ATOM records): (download) 
    >3rdmA (A:)
taeagitgtwynqlgstlivtagadgaltgtyesavgnaegsyvltgrydsapatdgsgt
algwtvawknnyrnahsastwsgqyvggaearintqvlttsgtteanawkstlvghdtft
kvk