PDB entry 3rch

View 3rch on RCSB PDB site
Description: Crystal structure of Human aromatic L-amino acid decarboxylase (AADC) in the open conformation with LLP and PLP bound to Chain-A and Chain-B respectively
Class: lyase
Keywords: apo enzyme, apo form, open conformation, open dimer, exposed, conformational change, Parkinson, AADC deficiency, DDC, LLP, PLP, decarboxylase, L-DOPA, internal aldimine, Shiff Base, LYASE
Deposited on 2011-03-31, released 2011-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-04, with a file datestamp of 2011-12-30.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.203
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aromatic L-amino acid decarboxylase
    Species: Homo sapiens [TaxId:9606]
    Gene: AADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rcha_
  • Chain 'B':
    Compound: aromatic L-amino acid decarboxylase
    Species: Homo sapiens [TaxId:9606]
    Gene: AADC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rchb_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rchA (A:)
    mnasefrrrgkemvdyvanymegiegrqvypdvepgylrplipaaapqepdtfediindv
    ekiimpgvthwhspyffayfptassypamladmlcgaigcigfswaaspacteletvmmd
    wlgkmlelpkaflnekagegggviqgsaseatlvallaartkvihrlqaaspeltqaaim
    eklvayssdqahssveragliggvklkaipsdgnfamrasalqealerdkaaglipffmv
    atlgtttccsfdnllevgpicnkediwlhvdaayagsaficpefrhllngvefadsfnfn
    phkwllvnfdcsamwvkkrtdltgafrldptylkhshqdsglitdyrhwqiplgrrfrsl
    kmwfvfrmygvkglqayirkhvqlshefeslvrqdprfeicvevilglvcfrlkgsnkvn
    eallqrinsakkihlvpchlrdkfvlrfaicsrtvesahvqrawehikelaadvlraere
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rchA (A:)
    mnasefrrrgkemvdyvanymegiegrqvypdvepgylrplipaaapqepdtfediindv
    ekiimpgvthwhspyffayfptassypamladmlcgaigcispacteletvmmdwlgkml
    elpkaflnekagegggviqgsaseatlvallaartkvihrlqaaspeltqaaimeklvay
    ssdqahssveragliggvklkaipsdgnfamrasalqealerdkaaglipffmvatlgtt
    tccsfdnllevgpicnkediwlhvdaayagsaficpefrhllngvefadsfnfnphkwll
    vnfdcsamwvkkrtdltgafrrfrslkmwfvfrmygvkglqayirkhvqlshefeslvrq
    dprfeicvevilglvcfrlkgsnkvneallqrinsakkihlvpchlrdkfvlrfaicsrt
    vesahvqrawehikelaadvlraere
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rchB (B:)
    mnasefrrrgkemvdyvanymegiegrqvypdvepgylrplipaaapqepdtfediindv
    ekiimpgvthwhspyffayfptassypamladmlcgaigcigfswaaspacteletvmmd
    wlgkmlelpkaflnekagegggviqgsaseatlvallaartkvihrlqaaspeltqaaim
    eklvayssdqahssveragliggvklkaipsdgnfamrasalqealerdkaaglipffmv
    atlgtttccsfdnllevgpicnkediwlhvdaayagsaficpefrhllngvefadsfnfn
    phkwllvnfdcsamwvkkrtdltgafrldptylkhshqdsglitdyrhwqiplgrrfrsl
    kmwfvfrmygvkglqayirkhvqlshefeslvrqdprfeicvevilglvcfrlkgsnkvn
    eallqrinsakkihlvpchlrdkfvlrfaicsrtvesahvqrawehikelaadvlraere
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rchB (B:)
    mnasefrrrgkemvdyvanymegiegrqvypdvepgylrplipaaapqepdtfediindv
    ekiimpgvthwhspyffayfptassypamladmlcgaigaspacteletvmmdwlgkmle
    lpkaflnekagegggviqgsaseatlvallaartkvihrlqaaspeltqaaimeklvays
    sdqahssveragliggvklkaipsdgnfamrasalqealerdkaaglipffmvatlgttt
    ccsfdnllevgpicnkediwlhvdaayagsaficpefrhllngvefadsfnfnphkwllv
    nfdcsamwvkkrtdlrfrslkmwfvfrmygvkglqayirkhvqlshefeslvrqdprfei
    cvevilglvcfrlkgsnkvneallqrinsakkihlvpchlrdkfvlrfaicsrtvesahv
    qrawehikelaadvlraere