PDB entry 3rbf

View 3rbf on RCSB PDB site
Description: Crystal structure of Human aromatic L-amino acid decarboxylase (AADC) in the apo form
Class: lyase
Keywords: apo enzyme, apo form, open conformation, open dimer, exposed, conformational change, Parkinson, AADC deficiency, DDC, Decarboxylase, PLP binding, LYASE
Deposited on 2011-03-29, released 2011-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aromatic-L-amino-acid decarboxylase
    Species: Homo sapiens [TaxId:9606]
    Gene: AADC, DDC, hCG_1811384, tcag7.584
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rbfa_
  • Chain 'B':
    Compound: Aromatic-L-amino-acid decarboxylase
    Species: Homo sapiens [TaxId:9606]
    Gene: AADC, DDC, hCG_1811384, tcag7.584
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rbfb_
  • Heterogens: PLP, CL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rbfA (A:)
    mnasefrrrgkemvdyvanymegiegrqvypdvepgylrplipaaapqepdtfediindv
    ekiimpgvthwhspyffayfptassypamladmlcgaigcigfswaaspacteletvmmd
    wlgkmlelpkaflnekagegggviqgsaseatlvallaartkvihrlqaaspeltqaaim
    eklvayssdqahssveragliggvklkaipsdgnfamrasalqealerdkaaglipffmv
    atlgtttccsfdnllevgpicnkediwlhvdaayagsaficpefrhllngvefadsfnfn
    phkwllvnfdcsamwvkkrtdltgafrldptylkhshqdsglitdyrhwqiplgrrfrsl
    kmwfvfrmygvkglqayirkhvqlshefeslvrqdprfeicvevilglvcfrlkgsnkvn
    eallqrinsakkihlvpchlrdkfvlrfaicsrtvesahvqrawehikelaadvlraere
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rbfA (A:)
    mnasefrrrgkemvdyvanymegiegrqvypdvepgylrplipaaapqepdtfediindv
    ekiimpgvthwhspyffayfptassypamladmlcgaigciaspacteletvmmdwlgkm
    lelpkaflnekagegggviqgsaseatlvallaartkvihrlqaaspeltqaaimeklva
    yssdqahssveragliggvklkaipsdgnfamrasalqealerdkaaglipffmvatlgt
    ttccsfdnllevgpicnkediwlhvdaayagsaficpefrhllngvefadsfnfnphkwl
    lvnfdcsamwvkkrtdlrrfrslkmwfvfrmygvkglqayirkhvqlshefeslvrqdpr
    feicvevilglvcfrlkgsnkvneallqrinsakkihlvpchlrdkfvlrfaicsrtves
    ahvqrawehikelaadvlraere
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rbfB (B:)
    mnasefrrrgkemvdyvanymegiegrqvypdvepgylrplipaaapqepdtfediindv
    ekiimpgvthwhspyffayfptassypamladmlcgaigcigfswaaspacteletvmmd
    wlgkmlelpkaflnekagegggviqgsaseatlvallaartkvihrlqaaspeltqaaim
    eklvayssdqahssveragliggvklkaipsdgnfamrasalqealerdkaaglipffmv
    atlgtttccsfdnllevgpicnkediwlhvdaayagsaficpefrhllngvefadsfnfn
    phkwllvnfdcsamwvkkrtdltgafrldptylkhshqdsglitdyrhwqiplgrrfrsl
    kmwfvfrmygvkglqayirkhvqlshefeslvrqdprfeicvevilglvcfrlkgsnkvn
    eallqrinsakkihlvpchlrdkfvlrfaicsrtvesahvqrawehikelaadvlraere
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rbfB (B:)
    mnasefrrrgkemvdyvanymegiegrqvypdvepgylrplipaaapqepdtfediindv
    ekiimpgvthwhspyffayfptassypamladmlcgaigswaaspacteletvmmdwlgk
    mlelpkaflnekagegggviqgsaseatlvallaartkvihrlqaaspeltqaaimeklv
    ayssdqahssveragliggvklkaipsdgnfamrasalqealerdkaaglipffmvatlg
    tttccsfdnllevgpicnkediwlhvdaayagsaficpefrhllngvefadsfnfnphkw
    llvnfdcsamwvkkrtdlrfrslkmwfvfrmygvkglqayirkhvqlshefeslvrqdpr
    feicvevilglvcfrlkgsnkvneallqrinsakkihlvpchlrdkfvlrfaicsrtves
    ahvqrawehikelaadvlraere