PDB entry 3rbb

View 3rbb on RCSB PDB site
Description: HIV-1 NEF protein in complex with engineered HCK SH3 domain
Class: viral protein, protein binding
Keywords: HIV-1 Nef, dileucine motif, SH3 domain, receptor internalization, PXXP motif, PROTEIN BINDING, VIRAL PROTEIN
Deposited on 2011-03-29, released 2011-04-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-06-29, with a file datestamp of 2011-06-24.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.206
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein Nef
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: HIV-1 Nef, nef
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3rbba_
  • Chain 'B':
    Compound: Tyrosine-protein kinase HCK
    Species: Homo sapiens [TaxId:9606]
    Gene: HCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08631 (1-60)
      • engineered mutation (12-17)
    Domains in SCOPe 2.06: d3rbbb_
  • Chain 'C':
    Compound: Protein Nef
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: HIV-1 Nef, nef
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3rbbc_
  • Chain 'D':
    Compound: Tyrosine-protein kinase HCK
    Species: Homo sapiens [TaxId:9606]
    Gene: HCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08631
      • engineered mutation (12-17)
    Domains in SCOPe 2.06: d3rbbd_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rbbA (A:)
    gamassntaatnadsawleaqeeeevgfpvrpqvplrpmtykaaldishflkekgglegl
    iwsqrrqeildlwiyhtqgyfpdwqnytpgpgirypltfgwcfklvpvepekveeanege
    nnsllhpmslhgmedaekevlvwrfdsklafhhmarelhpeyykda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rbbA (A:)
    fpvrpqvplrpmtykaaldishflkekgglegliwsqrrqeildlwiyhtqgyfpdwqny
    tpgpgirypltfgwcfklvpvepekveeanegennsllhpmslhgmedaekevlvwrfds
    klafhhmarelhpeyyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rbbB (B:)
    mediivvalydyyspfswdlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvd
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rbbB (B:)
    ediivvalydyyspfswdlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvds
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3rbbC (C:)
    gamassntaatnadsawleaqeeeevgfpvrpqvplrpmtykaaldishflkekgglegl
    iwsqrrqeildlwiyhtqgyfpdwqnytpgpgirypltfgwcfklvpvepekveeanege
    nnsllhpmslhgmedaekevlvwrfdsklafhhmarelhpeyykda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rbbC (C:)
    evgfpvrpqvplrpmtykaaldishflkekgglegliwsqrrqeildlwiyhtqgyfpdw
    qnytpgpgirypltfgwcfklvpvepeksllhpmaekevlvwrfdsklafhhmarelhpe
    yyk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3rbbD (D:)
    mediivvalydyyspfswdlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvd
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rbbD (D:)
    diivvalydyyspfswdlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvd