PDB entry 3ran

View 3ran on RCSB PDB site
Description: canine GDP-ran q69l mutant
Class: transport protein
Keywords: gtpase, nuclear transport, transport protein
Deposited on 1998-10-19, released 1998-12-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.176
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (GTP-binding nuclear protein ran)
    Species: Canis lupus [TaxId:9615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62825
      • engineered (68)
    Domains in SCOPe 2.03: d3rana_
  • Chain 'B':
    Compound: protein (GTP-binding nuclear protein ran)
    Species: Canis lupus [TaxId:9615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62825
      • engineered (68)
    Domains in SCOPe 2.03: d3ranb_
  • Chain 'C':
    Compound: protein (GTP-binding nuclear protein ran)
    Species: Canis lupus [TaxId:9615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62825
      • engineered (68)
    Domains in SCOPe 2.03: d3ranc_
  • Chain 'D':
    Compound: protein (GTP-binding nuclear protein ran)
    Species: Canis lupus [TaxId:9615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62825
      • engineered (68)
    Domains in SCOPe 2.03: d3rand_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ranA (A:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpik
    fnvwdtaglekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    alappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ranA (A:)
    gepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvw
    dtaglekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkv
    dikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalap
    pevvmdpalaaqyehdlevaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ranB (B:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpik
    fnvwdtaglekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    alappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ranB (B:)
    qgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnv
    wdtaglekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnk
    vdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampala
    ppevvmdpalaaqyehdlevaqtt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ranC (C:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpik
    fnvwdtaglekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    alappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ranC (C:)
    qgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnv
    wdtaglekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnk
    vdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampala
    ppevvmdpalaaqyehdlevaqt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ranD (D:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpik
    fnvwdtaglekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    alappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ranD (D:)
    qgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnv
    wdtaglekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnk
    vdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampala
    ppevvmdpalaaqyehdlevaqt